ANP32A polyclonal antibody (A01) View larger

ANP32A polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ANP32A polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ANP32A polyclonal antibody (A01)

Brand: Abnova
Reference: H00008125-A01
Product name: ANP32A polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a full-length recombinant ANP32A.
Gene id: 8125
Gene name: ANP32A
Gene alias: C15orf1|I1PP2A|LANP|MAPM|MGC119787|MGC150373|PHAP1|PHAPI|PP32
Gene description: acidic (leucine-rich) nuclear phosphoprotein 32 family, member A
Genbank accession: BC007200
Immunogen: ANP32A (AAH07200, 1 a.a. ~ 249 a.a) full-length recombinant protein with GST tag.
Immunogen sequence/protein sequence: MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD
Protein accession: AAH07200
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008125-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (53.5 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ANP32A polyclonal antibody (A01) now

Add to cart