TCL1A monoclonal antibody (M11), clone 1G10 View larger

TCL1A monoclonal antibody (M11), clone 1G10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TCL1A monoclonal antibody (M11), clone 1G10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about TCL1A monoclonal antibody (M11), clone 1G10

Brand: Abnova
Reference: H00008115-M11
Product name: TCL1A monoclonal antibody (M11), clone 1G10
Product description: Mouse monoclonal antibody raised against a partial recombinant TCL1A.
Clone: 1G10
Isotype: IgG1 Kappa
Gene id: 8115
Gene name: TCL1A
Gene alias: TCL1
Gene description: T-cell leukemia/lymphoma 1A
Genbank accession: NM_021966
Immunogen: TCL1A (NP_068801.1, 61 a.a. ~ 114 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD
Protein accession: NP_068801.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008115-M11-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged TCL1A is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy TCL1A monoclonal antibody (M11), clone 1G10 now

Add to cart