Brand: | Abnova |
Reference: | H00008115-M02A |
Product name: | TCL1A monoclonal antibody (M02A), clone 3G5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TCL1A. |
Clone: | 3G5 |
Isotype: | IgG2a Kappa |
Gene id: | 8115 |
Gene name: | TCL1A |
Gene alias: | TCL1 |
Gene description: | T-cell leukemia/lymphoma 1A |
Genbank accession: | NM_021966 |
Immunogen: | TCL1A (NP_068801.1, 61 a.a. ~ 114 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD |
Protein accession: | NP_068801.1 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | |
Application image note: | Immunoprecipitation of TCL1A transfected lysate using anti-TCL1A monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with TCL1A MaxPab rabbit polyclonal antibody. |
Applications: | ELISA,IP |
Shipping condition: | Dry Ice |