Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of IFT88 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about IFT88 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00008100-A01 |
| Product name: | IFT88 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant IFT88. |
| Gene id: | 8100 |
| Gene name: | IFT88 |
| Gene alias: | D13S1056E|DAF19|MGC26259|RP11-172H24.2|TG737|TTC10|hTg737 |
| Gene description: | intraflagellar transport 88 homolog (Chlamydomonas) |
| Genbank accession: | NM_175605 |
| Immunogen: | IFT88 (NP_783195, 724 a.a. ~ 833 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | RLEKMKEIREQRIKSGRDGSGGSRGKREGSASGDSGQNYSASSKGERLSARLRALPGTNEPYESSSNKEIDASYVDPLGPQIERPKTAAKKRIDEDDFADEELGDDLLPE |
| Protein accession: | NP_783195 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Disruption of intraflagellar protein transport in photoreceptor cilia causes Leber congenital amaurosis in humans and mice.Boldt K, Mans DA, Won J, van Reeuwijk J, Vogt A, Kinkl N, Letteboer SJ, Hicks WL, Hurd RE, Naggert JK, Texier Y, den Hollander AI, Koenekoop RK, Bennett J, Cremers FP, Gloeckner CJ, Nishina PM, Roepman R, Ueffing M. J Clin Invest. 2011 Jun 1;121(6):2169-80. doi: 10.1172/JCI45627. Epub 2011 May 23. |