HMGA2 monoclonal antibody (M04), clone 2D3 View larger

HMGA2 monoclonal antibody (M04), clone 2D3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HMGA2 monoclonal antibody (M04), clone 2D3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re

More info about HMGA2 monoclonal antibody (M04), clone 2D3

Brand: Abnova
Reference: H00008091-M04
Product name: HMGA2 monoclonal antibody (M04), clone 2D3
Product description: Mouse monoclonal antibody raised against a partial recombinant HMGA2.
Clone: 2D3
Isotype: IgG2a Kappa
Gene id: 8091
Gene name: HMGA2
Gene alias: BABL|HMGI-C|HMGIC|LIPO|STQTL9
Gene description: high mobility group AT-hook 2
Genbank accession: NM_003483
Immunogen: HMGA2 (NP_003474, 1 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSPSKAAQKKAEATGEKRPRGRPRKWPQQVVQKKP
Protein accession: NP_003474
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008091-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.86 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008091-M04-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to HMGA2 on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HMGA2 monoclonal antibody (M04), clone 2D3 now

Add to cart