Brand: | Abnova |
Reference: | H00008087-M01 |
Product name: | FXR1 monoclonal antibody (M01), clone 2G11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FXR1. |
Clone: | 2G11 |
Isotype: | IgG1 kappa |
Gene id: | 8087 |
Gene name: | FXR1 |
Gene alias: | - |
Gene description: | fragile X mental retardation, autosomal homolog 1 |
Genbank accession: | BC028983 |
Immunogen: | FXR1 (AAH28983, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VKKNTFFKCTVDVPEDLREACANENAHKDFKKAVGACRIFYHPETTQLMILSASEATVKRVNILSDMHLRSIRTKLMLMSRNEEATKHLECTKQLAAAFH |
Protein accession: | AAH28983 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00008087-M01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00008087-M01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00008087-M01-3-30-1-L.jpg](http://www.abnova.com/application_image/H00008087-M01-3-30-1-L.jpg) |
Application image note: | Immunoperoxidase of monoclonal antibody to FXR1 on formalin-fixed paraffin-embedded human colon adenocarcinoma. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |