Brand: | Abnova |
Reference: | H00008086-M02 |
Product name: | AAAS monoclonal antibody (M02), clone 5A1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant AAAS. |
Clone: | 5A1 |
Isotype: | IgG2a Kappa |
Gene id: | 8086 |
Gene name: | AAAS |
Gene alias: | AAA|AAASb|ADRACALA|ADRACALIN|ALADIN|DKFZp586G1624|GL003 |
Gene description: | achalasia, adrenocortical insufficiency, alacrimia (Allgrove, triple-A) |
Genbank accession: | NM_015665 |
Immunogen: | AAAS (NP_056480, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MCSLGLFPPPPPRGQVTLYEHNNELVTGSSYESPPPDFRGQWINLPVLQLTKDPLKTPGRLDHGTRTAFIHHREQVWKRCINIWRDVGLFGVLNEIANSE |
Protein accession: | NP_056480 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00008086-M02-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00008086-M02-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![H00008086-M02-3-33-1-L.jpg](http://www.abnova.com/application_image/H00008086-M02-3-33-1-L.jpg) |
Application image note: | Immunoperoxidase of monoclonal antibody to AAAS on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |