Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00008079-M01 |
Product name: | MLF2 monoclonal antibody (M01), clone 2F6-1E3 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant MLF2. |
Clone: | 2F6-1E3 |
Isotype: | IgG1 Kappa |
Gene id: | 8079 |
Gene name: | MLF2 |
Gene alias: | NTN4 |
Gene description: | myeloid leukemia factor 2 |
Genbank accession: | BC000898 |
Immunogen: | MLF2 (AAH00898, 1 a.a. ~ 248 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MFRFMRDVEPEDPMFLMDPFAIHRQHMSRMLSGGFGYSPFLSITDGNMPGTRPASRRMQQAGAVSPFGMLGMSGGFMDMFGMMNDMIGNMEHMTAGGNCQTFSSSTVISYSNTGDGAPKVYQETSEMRSAPGGIRETRRTVRDSDSGLEQMSIGHHIRDRAHILQRSRNHRTGDQEERQDYINLDESEAAAFDDEWRRETSRFRQQRPLEFRRLESSGAGGRRAEGPPRLAIQGPEDSPSRQSRRYDW |
Protein accession: | AAH00898 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (53.02 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of MLF2 expression in transfected 293T cell line by MLF2 monoclonal antibody (M01), clone 2F6-1E3. Lane 1: MLF2 transfected lysate(27.28 KDa). Lane 2: Non-transfected lysate. |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |