MLF2 MaxPab mouse polyclonal antibody (B01) View larger

MLF2 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MLF2 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,IF,WB-Tr

More info about MLF2 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00008079-B01
Product name: MLF2 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human MLF2 protein.
Gene id: 8079
Gene name: MLF2
Gene alias: NTN4
Gene description: myeloid leukemia factor 2
Genbank accession: NM_005439
Immunogen: MLF2 (NP_005430, 1 a.a. ~ 248 a.a) full-length human protein.
Immunogen sequence/protein sequence: MFRFMRDVEPEDPMFLMDPFAIHRQHMSRMLSGGFGYSPFLSITDGNMPGTRPASRRMQQAGAVSPFGMLGMSGGFMDMFGMMNDMIGNMEHMTAGGNCQTFSSSTVISYSNTGDGAPKVYQETSEMRSAPGGIRETRRTVRDSDSGLEQMSIGHHIRDRAHILQRSRNHRTGDQEERQDYINLDESEAAAFDDEWRRETSRFRQQRPLEFRRLESSGAGGRRAEGPPRLAIQGPEDSPSRQSRRYDW
Protein accession: NP_005430
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008079-B01-13-15-1.jpg
Application image note: Western Blot analysis of MLF2 expression in transfected 293T cell line (H00008079-T01) by MLF2 MaxPab polyclonal antibody.

Lane 1: MLF2 transfected lysate(27.28 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MLF2 MaxPab mouse polyclonal antibody (B01) now

Add to cart