FOSL1 purified MaxPab rabbit polyclonal antibody (D01P) View larger

FOSL1 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FOSL1 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,WB-Tr

More info about FOSL1 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00008061-D01P
Product name: FOSL1 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human FOSL1 protein.
Gene id: 8061
Gene name: FOSL1
Gene alias: FRA|FRA1|fra-1
Gene description: FOS-like antigen 1
Genbank accession: NM_005438.2
Immunogen: FOSL1 (NP_005429.1, 1 a.a. ~ 271 a.a) full-length human protein.
Immunogen sequence/protein sequence: MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKEGDTGSTSGTSSPPAPCRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEPCASAHRKSSSSSGDPSSDPLGSPTLLAL
Protein accession: NP_005429.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00008061-D01P-1-4-1.jpg
Application image note: FOSL1 MaxPab rabbit polyclonal antibody. Western Blot analysis of FOSL1 expression in A-431.
Applications: WB-Ce,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FOSL1 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart