Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SLC25A16 monoclonal antibody (M01), clone 1H7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA |
More info about SLC25A16 monoclonal antibody (M01), clone 1H7
| Brand: | Abnova |
| Reference: | H00008034-M01 |
| Product name: | SLC25A16 monoclonal antibody (M01), clone 1H7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC25A16. |
| Clone: | 1H7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 8034 |
| Gene name: | SLC25A16 |
| Gene alias: | D10S105E|GDA|GDC|HGT.1|MGC39851|ML7|hML7 |
| Gene description: | solute carrier family 25 (mitochondrial carrier; Graves disease autoantigen), member 16 |
| Genbank accession: | NM_152707 |
| Immunogen: | SLC25A16 (NP_689920.1, 59 a.a. ~ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RVKVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMMIRIFPYGAIQFMAFEHYKTLITTKLGISGHVHR |
| Protein accession: | NP_689920.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SLC25A16 monoclonal antibody (M01), clone 1H7. Western Blot analysis of SLC25A16 expression in HeLa(Cat # L013V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |