Brand: | Abnova |
Reference: | H00008031-M04 |
Product name: | NCOA4 monoclonal antibody (M04), clone 1B7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NCOA4. |
Clone: | 1B7 |
Isotype: | IgG1 Kappa |
Gene id: | 8031 |
Gene name: | NCOA4 |
Gene alias: | ARA70|DKFZp762E1112|ELE1|PTC3|RFG |
Gene description: | nuclear receptor coactivator 4 |
Genbank accession: | NM_005437 |
Immunogen: | NCOA4 (NP_005428, 505 a.a. ~ 614 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EGSPKEVPGTEDRAGKQKFKSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQM |
Protein accession: | NP_005428 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00008031-M04-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00008031-M04-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: | ![H00008031-M04-4-8-1-L.jpg](http://www.abnova.com/application_image/H00008031-M04-4-8-1-L.jpg) |
Application image note: | Immunofluorescence of monoclonal antibody to NCOA4 on NIH/3T3 cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Molecular constitution of breast but not other reproductive tissues is rich in growth promoting molecules: A possible link to highest incidence of tumor growths.Poola I, Abraham J, Marshalleck JJ, Yue Q, Fu SW, Viswanath L, Sharma N, Hill R, Dewitty RL, Bonney G. FEBS Lett. 2009 Sep 17;583(18):3069-75. Epub 2009 Aug 19. |