Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MLLT10 monoclonal antibody (M03), clone 6H7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,ELISA |
More info about MLLT10 monoclonal antibody (M03), clone 6H7
| Brand: | Abnova |
| Reference: | H00008028-M03 |
| Product name: | MLLT10 monoclonal antibody (M03), clone 6H7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MLLT10. |
| Clone: | 6H7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 8028 |
| Gene name: | MLLT10 |
| Gene alias: | AF10|DKFZp686E10210|MGC75086 |
| Gene description: | myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 10 |
| Genbank accession: | NM_001009569 |
| Immunogen: | MLLT10 (NP_001009569, 695 a.a. ~ 793 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QIRYDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSH |
| Protein accession: | NP_001009569 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | MLLT10 monoclonal antibody (M03), clone 6H7 Western Blot analysis of MLLT10 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,ELISA |
| Shipping condition: | Dry Ice |