Brand: | Abnova |
Reference: | H00008028-M01 |
Product name: | MLLT10 monoclonal antibody (M01), clone 6H8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MLLT10. |
Clone: | 6H8 |
Isotype: | IgG1 Kappa |
Gene id: | 8028 |
Gene name: | MLLT10 |
Gene alias: | AF10|DKFZp686E10210|MGC75086 |
Gene description: | myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 10 |
Genbank accession: | NM_001009569 |
Immunogen: | MLLT10 (NP_001009569, 695 a.a. ~ 793 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QIRYDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSH |
Protein accession: | NP_001009569 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: | |
Application image note: | MLLT10 monoclonal antibody (M01), clone 6H8 Western Blot analysis of MLLT10 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |