Brand: | Abnova |
Reference: | H00008027-M01 |
Product name: | STAM monoclonal antibody (M01), clone 2B11-1G1 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant STAM. |
Clone: | 2B11-1G1 |
Isotype: | IgG1 Kappa |
Gene id: | 8027 |
Gene name: | STAM |
Gene alias: | DKFZp686J2352|STAM1 |
Gene description: | signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 |
Genbank accession: | BC030586 |
Immunogen: | STAM (AAH30586, 1 a.a. ~ 403 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPHVAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFKNDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAIELSLKEQRQQSTTLSTLYPSTSSLLTNHQHEGRKVRAIYDFEAAEDNELTFKAGEIITVLDDSDPNWWKGETHQGIGLFPSNFVTAYLTAEPEMIKTEKKTVQFSDDVQVETIEPEPEPAFIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSELNVKVMEALSLYTKLMNEDPMYSMYAKLQNQPGSGPTIRKPSPS |
Protein accession: | AAH30586 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00008027-M01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00008027-M01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (70.07 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00008027-M01-3-36-1-L.jpg](http://www.abnova.com/application_image/H00008027-M01-3-36-1-L.jpg) |
Application image note: | Immunoperoxidase of monoclonal antibody to STAM on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |