Brand: | Abnova |
Reference: | H00008022-M08 |
Product name: | LHX3 monoclonal antibody (M08), clone 2C10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant LHX3. |
Clone: | 2C10 |
Isotype: | IgG2a Kappa |
Gene id: | 8022 |
Gene name: | LHX3 |
Gene alias: | DKFZp762A2013|LIM3|M2-LHX3 |
Gene description: | LIM homeobox 3 |
Genbank accession: | NM_014564 |
Immunogen: | LHX3 (NP_055379, 228 a.a. ~ 316 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RWGQYFRNMKRSRGGSKSDKDSVQEGQDSDAEVSFPDEPSLAEMGPANGLYGSLGEPTQALGRPSGALGNFSLEHGGLAGPEQYRELRP |
Protein accession: | NP_055379 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | |
Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | |
Application image note: | Immunofluorescence of monoclonal antibody to LHX3 on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |