BRD3 monoclonal antibody (M03A), clone 6C10 View larger

BRD3 monoclonal antibody (M03A), clone 6C10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BRD3 monoclonal antibody (M03A), clone 6C10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,ELISA,WB-Re

More info about BRD3 monoclonal antibody (M03A), clone 6C10

Brand: Abnova
Reference: H00008019-M03A
Product name: BRD3 monoclonal antibody (M03A), clone 6C10
Product description: Mouse monoclonal antibody raised against a partial recombinant BRD3.
Clone: 6C10
Isotype: IgG1 Kappa
Gene id: 8019
Gene name: BRD3
Gene alias: FLJ23227|FLJ41328|KIAA0043|ORFX|RING3L
Gene description: bromodomain containing 3
Genbank accession: BC032124
Immunogen: BRD3 (AAH32124, 418 a.a. ~ 556 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EPVEAPALPAPAAPMVSKGAESSRSSEESSSDSGSSDSEEERATRLAELQEQLKAVHEQLAALSQAPVNKPKKKKEKKEKEKKKKDKEKEKEKHKVKAEEEKKAKVAPPAKQAQQKKAPAKKANSTTTAGRDHFLTCGV
Protein accession: AAH32124
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008019-M03A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (40.92 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008019-M03A-1-25-1.jpg
Application image note: BRD3 monoclonal antibody (M03A), clone 6C10 Western Blot analysis of BRD3 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,WB-Ti,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy BRD3 monoclonal antibody (M03A), clone 6C10 now

Add to cart