Brand: | Abnova |
Reference: | H00008019-M02 |
Product name: | BRD3 monoclonal antibody (M02), clone 7G6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant BRD3. |
Clone: | 7G6 |
Isotype: | IgG3 Kappa |
Gene id: | 8019 |
Gene name: | BRD3 |
Gene alias: | FLJ23227|FLJ41328|KIAA0043|ORFX|RING3L |
Gene description: | bromodomain containing 3 |
Genbank accession: | BC032124 |
Immunogen: | BRD3 (AAH32124, 418 a.a. ~ 556 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EPVEAPALPAPAAPMVSKGAESSRSSEESSSDSGSSDSEEERATRLAELQEQLKAVHEQLAALSQAPVNKPKKKKEKKEKEKKKKDKEKEKEKHKVKAEEEKKAKVAPPAKQAQQKKAPAKKANSTTTAGRDHFLTCGV |
Protein accession: | AAH32124 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | |
Quality control testing picture note: | Western Blot detection against Immunogen (40.92 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | |
Application image note: | Immunoperoxidase of monoclonal antibody to BRD3 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |