Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NR4A3 monoclonal antibody (M06), clone 1E11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re |
More info about NR4A3 monoclonal antibody (M06), clone 1E11
| Brand: | Abnova |
| Reference: | H00008013-M06 |
| Product name: | NR4A3 monoclonal antibody (M06), clone 1E11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NR4A3. |
| Clone: | 1E11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 8013 |
| Gene name: | NR4A3 |
| Gene alias: | CHN|CSMF|MINOR|NOR1|TEC |
| Gene description: | nuclear receptor subfamily 4, group A, member 3 |
| Genbank accession: | NM_006981 |
| Immunogen: | NR4A3 (NP_008912, 414 a.a. ~ 521 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LDYSRYCPTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFVLRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFS |
| Protein accession: | NP_008912 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to NR4A3 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | The nuclear receptor NOR-1 regulates the small muscle protein, X-linked (SMPX) and myotube differentiation.Ferran B, Marti-Pamies I, Alonso J, Rodriguez-Calvo R, Aguilo S, Vidal F, Rodriguez C, Martinez-Gonzalez J. Sci Rep. 2016 May 16;6:25944. |