NR4A3 monoclonal antibody (M02), clone 1E9 View larger

NR4A3 monoclonal antibody (M02), clone 1E9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NR4A3 monoclonal antibody (M02), clone 1E9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about NR4A3 monoclonal antibody (M02), clone 1E9

Brand: Abnova
Reference: H00008013-M02
Product name: NR4A3 monoclonal antibody (M02), clone 1E9
Product description: Mouse monoclonal antibody raised against a partial recombinant NR4A3.
Clone: 1E9
Isotype: IgG2a Kappa
Gene id: 8013
Gene name: NR4A3
Gene alias: CHN|CSMF|MINOR|NOR1|TEC
Gene description: nuclear receptor subfamily 4, group A, member 3
Genbank accession: NM_006981
Immunogen: NR4A3 (NP_008912, 414 a.a. ~ 521 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LDYSRYCPTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFVLRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFS
Protein accession: NP_008912
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008013-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.62 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008013-M02-1-25-1.jpg
Application image note: NR4A3 monoclonal antibody (M02), clone 1E9 Western Blot analysis of NR4A3 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NR4A3 monoclonal antibody (M02), clone 1E9 now

Add to cart