Brand: | Abnova |
Reference: | H00008000-M02 |
Product name: | PSCA monoclonal antibody (M02), clone 1E1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PSCA. |
Clone: | 1E1 |
Isotype: | IgG2b Kappa |
Gene id: | 8000 |
Gene name: | PSCA |
Gene alias: | PRO232 |
Gene description: | prostate stem cell antigen |
Genbank accession: | NM_005672 |
Immunogen: | PSCA (NP_005663, 23 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | CYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS |
Protein accession: | NP_005663 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00008000-M02-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00008000-M02-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (33.77 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00008000-M02-9-22-1.jpg](http://www.abnova.com/application_image/H00008000-M02-9-22-1.jpg) |
Application image note: | Detection limit for recombinant GST tagged PSCA is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |