Brand: | Abnova |
Reference: | H00007994-M07 |
Product name: | MYST3 monoclonal antibody (M07), clone 4D8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MYST3. |
Clone: | 4D8 |
Isotype: | IgG2b Kappa |
Gene id: | 7994 |
Gene name: | MYST3 |
Gene alias: | KAT6A|MGC167033|MOZ|RUNXBP2|ZNF220 |
Gene description: | MYST histone acetyltransferase (monocytic leukemia) 3 |
Genbank accession: | NM_006766 |
Immunogen: | MYST3 (NP_006757, 81 a.a. ~ 179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ALPKPRNHGKLDNKQNVDWNKLIKRAVEGLAESGGSTLKSIERFLKGQKDVSALFGGSAASGFHQQLRLAIKRAIGHGRLLKDGPLYRLNTKATNVDGK |
Protein accession: | NP_006757 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00007994-M07-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00007994-M07-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00007994-M07-3-41-1-L.jpg](http://www.abnova.com/application_image/H00007994-M07-3-41-1-L.jpg) |
Application image note: | Immunoperoxidase of monoclonal antibody to MYST3 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |