Brand: | Abnova |
Reference: | H00007976-M02 |
Product name: | FZD3 monoclonal antibody (M02), clone 1B8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FZD3. |
Clone: | 1B8 |
Isotype: | IgG2a Kappa |
Gene id: | 7976 |
Gene name: | FZD3 |
Gene alias: | Fz-3|hFz3 |
Gene description: | frizzled homolog 3 (Drosophila) |
Genbank accession: | NM_017412 |
Immunogen: | FZD3 (NP_059108, 55 a.a. ~ 157 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QQTAALAMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVPWPEDMECSRFPDCDEPYPRLVDLNLAGEPTEGAPVAV |
Protein accession: | NP_059108 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00007976-M02-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00007976-M02-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (37.07 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00007976-M02-9-19-1.jpg](http://www.abnova.com/application_image/H00007976-M02-9-19-1.jpg) |
Application image note: | Detection limit for recombinant GST tagged FZD3 is approximately 1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Identification of WNT/{beta}-CATENIN signaling pathway components in human cumulus cells.Wang HX, Tekpetey FR, Kidder GM. Mol Hum Reprod. 2009 Jan;15(1):11-7. Epub 2008 Nov 26. |