Brand: | Abnova |
Reference: | H00007923-Q01 |
Product name: | HSD17B8 (Human) Recombinant Protein (Q01) |
Product description: | Human HSD17B8 partial ORF ( NP_055049, 28 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 7923 |
Gene name: | HSD17B8 |
Gene alias: | D6S2245E|FABG|FABGL|H2-KE6|HKE6|KE6|RING2|SDR30C1|dJ1033B10.9 |
Gene description: | hydroxysteroid (17-beta) dehydrogenase 8 |
Genbank accession: | NM_014234 |
Immunogen sequence/protein sequence: | SVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVN |
Protein accession: | NP_055049 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quality control testing picture: |  |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |