Brand: | Abnova |
Reference: | H00007923-M01 |
Product name: | HSD17B8 monoclonal antibody (M01), clone 4F1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HSD17B8. |
Clone: | 4F1 |
Isotype: | IgG1 Kappa |
Gene id: | 7923 |
Gene name: | HSD17B8 |
Gene alias: | D6S2245E|FABG|FABGL|H2-KE6|HKE6|KE6|RING2|SDR30C1|dJ1033B10.9 |
Gene description: | hydroxysteroid (17-beta) dehydrogenase 8 |
Genbank accession: | NM_014234 |
Immunogen: | HSD17B8 (NP_055049, 28 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVN |
Protein accession: | NP_055049 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00007923-M01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00007923-M01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00007923-M01-2-A7-1.jpg](http://www.abnova.com/application_image/H00007923-M01-2-A7-1.jpg) |
Application image note: | HSD17B8 monoclonal antibody (M01), clone 4F1. Western Blot analysis of HSD17B8 expression in human pancreas. |
Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |