Brand: | Abnova |
Reference: | H00007905-M04 |
Product name: | C5orf18 monoclonal antibody (M04), clone 3G11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant C5orf18. |
Clone: | 3G11 |
Isotype: | IgG2a Kappa |
Gene id: | 7905 |
Gene name: | REEP5 |
Gene alias: | C5orf18|D5S346|DP1|MGC70440|TB2 |
Gene description: | receptor accessory protein 5 |
Genbank accession: | NM_005669 |
Immunogen: | C5orf18 (NP_005660, 113 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKS |
Protein accession: | NP_005660 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.66 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged REEP5 is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |