Brand: | Abnova |
Reference: | H00007873-M01 |
Product name: | ARMET monoclonal antibody (M01), clone 1D10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ARMET. |
Clone: | 1D10 |
Isotype: | IgG1 Kappa |
Gene id: | 7873 |
Gene name: | ARMET |
Gene alias: | ARP|MANF|MGC142148|MGC142150 |
Gene description: | arginine-rich, mutated in early stage tumors |
Genbank accession: | NM_006010 |
Immunogen: | ARMET (NP_006001.2, 116 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DSQICELKYDKQIDLSTVDLKKLRVKELKKILDDWGETCKGCAEKSDYIRKINELMPKYAPKAASARTDL |
Protein accession: | NP_006001.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.33 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ARMET is 0.03 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Mesencephalic astrocyte-derived neurotrophic factor reduces cell apoptosis via upregulating GRP78 in SH-SY5Y cells.Huang J, Chen C, Gu H, Li C, Fu X, Jiang M, Sun H, Xu J, Fang J, Jin L. Cell Biol Int. 2016 May 4. [Epub ahead of print] |