Brand: | Abnova |
Reference: | H00007871-M08 |
Product name: | SLMAP monoclonal antibody (M08), clone 2A7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SLMAP. |
Clone: | 2A7 |
Isotype: | IgG2a Kappa |
Gene id: | 7871 |
Gene name: | SLMAP |
Gene alias: | FLJ42206|KIAA1601|MGC138760|MGC138761|SLAP |
Gene description: | sarcolemma associated protein |
Genbank accession: | NM_007159 |
Immunogen: | SLMAP (NP_009090, 677 a.a. ~ 784 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LHNSQKQSLELTSDLSILQMSRKELENQVGSLKEQHLRDSADLKTLLSKAENQAKDVQKEYEKTQTVLSELKLKFEMTEQEKQSITDELKQCKNNLKLLREKGNNKPW |
Protein accession: | NP_009090 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00007871-M08-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00007871-M08-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00007871-M08-1-4-1.jpg](http://www.abnova.com/application_image/H00007871-M08-1-4-1.jpg) |
Application image note: | SLMAP monoclonal antibody (M08), clone 2A7 Western Blot analysis of SLMAP expression in A-431 ( Cat # L015V1 ). |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Tail-anchored membrane protein SLMAP is a novel regulator of cardiac function at the sarcoplasmic reticulum.Nader M, Westendorp B, Hawari O, Salih M, Stewart AF, Leenen FH, Tuana BS. Am J Physiol Heart Circ Physiol. 2012 Mar;302(5):H1138-45. Epub 2011 Dec 16. |