Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MAPKAPK3 monoclonal antibody (M02), clone 2B5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,PLA-Ce |
More info about MAPKAPK3 monoclonal antibody (M02), clone 2B5
| Brand: | Abnova |
| Reference: | H00007867-M02 |
| Product name: | MAPKAPK3 monoclonal antibody (M02), clone 2B5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MAPKAPK3. |
| Clone: | 2B5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7867 |
| Gene name: | MAPKAPK3 |
| Gene alias: | 3PK|MAPKAP3 |
| Gene description: | mitogen-activated protein kinase-activated protein kinase 3 |
| Genbank accession: | BC001662 |
| Immunogen: | MAPKAPK3 (AAH01662, 272 a.a. ~ 382 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EVSEDAKQLIRLLLKTDPTERLTITQFMNHPWINQSMVVPQTPLHTARVLQEDKDHWDEVKEEMTSALATMRVDYDQVKIKDLKTSNNRLLNKRRKKQAGSSSASQGCNNQ |
| Protein accession: | AAH01662 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to MAPKAPK3 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,PLA-Ce |
| Shipping condition: | Dry Ice |