Brand: | Abnova |
Reference: | H00007867-M01 |
Product name: | MAPKAPK3 monoclonal antibody (M01), clone 3F4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MAPKAPK3. |
Clone: | 3F4 |
Isotype: | IgG2a Kappa |
Gene id: | 7867 |
Gene name: | MAPKAPK3 |
Gene alias: | 3PK|MAPKAP3 |
Gene description: | mitogen-activated protein kinase-activated protein kinase 3 |
Genbank accession: | BC001662 |
Immunogen: | MAPKAPK3 (AAH01662, 272 a.a. ~ 382 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EVSEDAKQLIRLLLKTDPTERLTITQFMNHPWINQSMVVPQTPLHTARVLQEDKDHWDEVKEEMTSALATMRVDYDQVKIKDLKTSNNRLLNKRRKKQAGSSSASQGCNNQ |
Protein accession: | AAH01662 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00007867-M01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00007867-M01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: | ![H00007867-M01-1-1-1.jpg](http://www.abnova.com/application_image/H00007867-M01-1-1-1.jpg) |
Application image note: | MAPKAPK3 monoclonal antibody (M01), clone 3F4 Western Blot analysis of MAPKAPK3 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |