PAX8 monoclonal antibody (M05), clone 3E9 View larger

PAX8 monoclonal antibody (M05), clone 3E9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PAX8 monoclonal antibody (M05), clone 3E9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Tr

More info about PAX8 monoclonal antibody (M05), clone 3E9

Brand: Abnova
Reference: H00007849-M05
Product name: PAX8 monoclonal antibody (M05), clone 3E9
Product description: Mouse monoclonal antibody raised against a partial recombinant PAX8.
Clone: 3E9
Isotype: IgG2a Kappa
Gene id: 7849
Gene name: PAX8
Gene alias: -
Gene description: paired box 8
Genbank accession: NM_003466
Immunogen: PAX8 (NP_003457, 300 a.a. ~ 377 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DPHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPH
Protein accession: NP_003457
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007849-M05-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged PAX8 is approximately 3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PAX8 monoclonal antibody (M05), clone 3E9 now

Add to cart