PXDN polyclonal antibody (A01) View larger

PXDN polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PXDN polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about PXDN polyclonal antibody (A01)

Brand: Abnova
Reference: H00007837-A01
Product name: PXDN polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant PXDN.
Gene id: 7837
Gene name: PXDN
Gene alias: D2S448|D2S448E|KIAA0230|MG50|PRG2|PXN|VPO
Gene description: peroxidasin homolog (Drosophila)
Genbank accession: XM_056455
Immunogen: PXDN (XP_056455, 1452 a.a. ~ 1561 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: STSAFSTRSDASGTNDFREFVLEMQKTITDLRTQIKKLESRLSTTECVDAGGESHANNTKWKKDACTICECKDGQVTCFVEACPPATCAVPVNIPGACCPVCLQKRAEEK
Protein accession: XP_056455
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007837-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PXDN polyclonal antibody (A01) now

Add to cart