Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DAP3 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about DAP3 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00007818-A01 |
| Product name: | DAP3 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant DAP3. |
| Gene id: | 7818 |
| Gene name: | DAP3 |
| Gene alias: | DAP-3|DKFZp686G12159|MGC126058|MGC126059|MRP-S29|MRPS29|bMRP-10 |
| Gene description: | death associated protein 3 |
| Genbank accession: | NM_004632 |
| Immunogen: | DAP3 (NP_004623, 237 a.a. ~ 343 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | TDAVGIVLKELKRQSSLGMFHLLVAVDGINALWGRTTLKREDKSPIAPEELALVHNLRKMMKNDWHGGAIVSALSQTGSLFKPRKAYLPQELLGKEGFDALDPFIPI |
| Protein accession: | NP_004623 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |
| Publications: | Substrate Trapping Proteomics Reveals Targets of the βTrCP2/FBXW11 Ubiquitin Ligase.Kim TY, Siesser PF, Rossman KL, Goldfarb D, Mackinnon K, Yan F, Yi X, MacCoss MJ, Moon RT, Der CJ, Major MB Mol Cell Biol. 2014 Oct 20. pii: MCB.00857-14. |