BSND monoclonal antibody (M01), clone 1E8 View larger

BSND monoclonal antibody (M01), clone 1E8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BSND monoclonal antibody (M01), clone 1E8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about BSND monoclonal antibody (M01), clone 1E8

Brand: Abnova
Reference: H00007809-M01
Product name: BSND monoclonal antibody (M01), clone 1E8
Product description: Mouse monoclonal antibody raised against a partial recombinant BSND.
Clone: 1E8
Isotype: IgG2b Kappa
Gene id: 7809
Gene name: BSND
Gene alias: BART|MGC119283|MGC119284|MGC119285
Gene description: Bartter syndrome, infantile, with sensorineural deafness (Barttin)
Genbank accession: NM_057176
Immunogen: BSND (NP_476517.1, 221 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ACSPQQEPQGCRCPLDRFQDFALIDAPTLEDEPQEGQQWEIALPNNWQRYPRTKVEEKEASDTGGEEPEKEEEDLYYGLPDGAGDLLPDKELGFEPDTQG
Protein accession: NP_476517.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007809-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007809-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged BSND is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy BSND monoclonal antibody (M01), clone 1E8 now

Add to cart