BSND MaxPab rabbit polyclonal antibody (D01) View larger

BSND MaxPab rabbit polyclonal antibody (D01)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BSND MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr,IP

More info about BSND MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00007809-D01
Product name: BSND MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human BSND protein.
Gene id: 7809
Gene name: BSND
Gene alias: BART|MGC119283|MGC119284|MGC119285
Gene description: Bartter syndrome, infantile, with sensorineural deafness (Barttin)
Genbank accession: NM_057176.2
Immunogen: BSND (NP_476517.1, 1 a.a. ~ 320 a.a) full-length human protein.
Immunogen sequence/protein sequence: MADEKTFRIGFIVLGLFLLALGTFLMSHDRPQVYGTFYAMGSVMVIGGIIWSMCQCYPKITFVPADSDFQGILSPKAMGLLENGLAAEMKSPSPQPPYVRLWEEAAYDQSLPDFSHIQMKVMSYSEDHRSLLAPEMGQPKLGTSDGGEGGPGDVQAWMEAAVVIHKGSDESEGERRLTQSWPGPLACPQGPAPLASFQDDLDMDSSEGSSPNASPHDREEACSPQQEPQGCRCPLDRFQDFALIDAPTLEDEPQEGQQWEIALPNNWQRYPRTKVEEKEASDTGGEEPEKEEEDLYYGLPDGAGDLLPDKELGFEPDTQG
Protein accession: NP_476517.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00007809-D01-13-15-1.jpg
Application image note: Western Blot analysis of BSND expression in transfected 293T cell line (H00007809-T01) by BSND MaxPab polyclonal antibody.

Lane 1: BSND transfected lysate(35.20 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy BSND MaxPab rabbit polyclonal antibody (D01) now

Add to cart