BSND purified MaxPab mouse polyclonal antibody (B01P) View larger

BSND purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BSND purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,WB-Tr

More info about BSND purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00007809-B01P
Product name: BSND purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human BSND protein.
Gene id: 7809
Gene name: BSND
Gene alias: BART|MGC119283|MGC119284|MGC119285
Gene description: Bartter syndrome, infantile, with sensorineural deafness (Barttin)
Genbank accession: NM_057176.2
Immunogen: BSND (NP_476517.1, 1 a.a. ~ 320 a.a) full-length human protein.
Immunogen sequence/protein sequence: MADEKTFRIGFIVLGLFLLALGTFLMSHDRPQVYGTFYAMGSVMVIGGIIWSMCQCYPKITFVPADSDFQGILSPKAMGLLENGLAAEMKSPSPQPPYVRLWEEAAYDQSLPDFSHIQMKVMSYSEDHRSLLAPEMGQPKLGTSDGGEGGPGDVQAWMEAAVVIHKGSDESEGERRLTQSWPGPLACPQGPAPLASFQDDLDMDSSEGSSPNASPHDREEACSPQQEPQGCRCPLDRFQDFALIDAPTLEDEPQEGQQWEIALPNNWQRYPRTKVEEKEASDTGGEEPEKEEEDLYYGLPDGAGDLLPDKELGFEPDTQG
Protein accession: NP_476517.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007809-B01P-13-15-1.jpg
Application image note: Western Blot analysis of BSND expression in transfected 293T cell line (H00007809-T01) by BSND MaxPab polyclonal antibody.

Lane 1: BSND transfected lysate(35.2 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy BSND purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart