Brand: | Abnova |
Reference: | H00007804-M01 |
Product name: | LRP8 monoclonal antibody (M01), clone 3H2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant LRP8. |
Clone: | 3H2 |
Isotype: | IgG1 Kappa |
Gene id: | 7804 |
Gene name: | LRP8 |
Gene alias: | APOER2|HSZ75190|MCI1 |
Gene description: | low density lipoprotein receptor-related protein 8, apolipoprotein e receptor |
Genbank accession: | NM_004631 |
Immunogen: | LRP8 (NP_004622, 83 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KKTCADSDFTCDNGHCIHERWKCDGEEECPDGSDESEATCTKQVCPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCATLCAPH |
Protein accession: | NP_004622 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.42 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged LRP8 is approximately 0.03ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | PCSK9 is not involved in the degradation of LDL receptors and BACE1 in the adult mouse brain.Liu M, Wu G, Baysarowich J, Kavana M, Addona GH, Bierilo KK, Mudgett JS, Pavlovic G, Sitlani A, Renger JJ, Hubbard BK, Fisher TS, Zerbinatti CV. J Lipid Res. 2010 Sep;51(9):2611-8. Epub 2010 May 7. |