Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P,S-ELISA,ELISA,WB-Tr |
Brand: | Abnova |
Reference: | H00007775-M06 |
Product name: | ZNF232 monoclonal antibody (M06), clone 1F8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ZNF232. |
Clone: | 1F8 |
Isotype: | IgG2a Kappa |
Gene id: | 7775 |
Gene name: | ZNF232 |
Gene alias: | ZSCAN11 |
Gene description: | zinc finger protein 232 |
Genbank accession: | NM_014519 |
Immunogen: | ZNF232 (NP_055334.2, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EKKESLGAAQEALSIQLQPKETQPFPKSEQVYLHFLSVVTEDGPEPKDKGSLPQPPITEVESQVFSEKLATDTSTFEATSEGTLELQQRNPKAERLRWSP |
Protein accession: | NP_055334.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of ZNF232 expression in transfected 293T cell line by ZNF232 monoclonal antibody (M06), clone 1F8. Lane 1: ZNF232 transfected lysate(50.7 KDa). Lane 2: Non-transfected lysate. |
Applications: | IHC-P,S-ELISA,ELISA,WB-Tr |
Shipping condition: | Dry Ice |