ZNF180 monoclonal antibody (M01), clone 4F3 View larger

ZNF180 monoclonal antibody (M01), clone 4F3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF180 monoclonal antibody (M01), clone 4F3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about ZNF180 monoclonal antibody (M01), clone 4F3

Brand: Abnova
Reference: H00007733-M01
Product name: ZNF180 monoclonal antibody (M01), clone 4F3
Product description: Mouse monoclonal antibody raised against a partial recombinant ZNF180.
Clone: 4F3
Isotype: IgG2a Kappa
Gene id: 7733
Gene name: ZNF180
Gene alias: HHZ168
Gene description: zinc finger protein 180
Genbank accession: NM_013256
Immunogen: ZNF180 (NP_037388.1, 176 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VAFTQRKAVIHERVCKSDETGEKSGLNSSLFSSPVIPIRNHFHKHVSHAKKWHLNAAVNSHQKINENETLYENNECGKPPQSIHLIQFTRTQTKDKSYGFSDRIQSFCHG
Protein accession: NP_037388.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007733-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007733-M01-13-15-1.jpg
Application image note: Western Blot analysis of ZNF180 expression in transfected 293T cell line by ZNF180 monoclonal antibody (M01), clone 4F3.

Lane 1: ZNF180 transfected lysate(79.3 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ZNF180 monoclonal antibody (M01), clone 4F3 now

Add to cart