ZNF175 monoclonal antibody (M01), clone 1C2 View larger

ZNF175 monoclonal antibody (M01), clone 1C2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF175 monoclonal antibody (M01), clone 1C2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re,WB-Tr

More info about ZNF175 monoclonal antibody (M01), clone 1C2

Brand: Abnova
Reference: H00007728-M01
Product name: ZNF175 monoclonal antibody (M01), clone 1C2
Product description: Mouse monoclonal antibody raised against a partial recombinant ZNF175.
Clone: 1C2
Isotype: IgG2a Kappa
Gene id: 7728
Gene name: ZNF175
Gene alias: OTK18
Gene description: zinc finger protein 175
Genbank accession: NM_007147
Immunogen: ZNF175 (NP_009078, 81 a.a. ~ 178 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KEKEPRVEEAEVSHQRCQEREFGLEIPQKEISKKASFQKDMVGEFTRDGSWCSILEELRLDADRTKKDEQNQIQPMSHSAFFNKKTLNTESNCEYKDP
Protein accession: NP_009078
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007728-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007728-M01-13-15-1.jpg
Application image note: Western Blot analysis of ZNF175 expression in transfected 293T cell line by ZNF175 monoclonal antibody (M01), clone 1C2.

Lane 1: ZNF175 transfected lysate(81.6 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ZNF175 monoclonal antibody (M01), clone 1C2 now

Add to cart