ZNF174 monoclonal antibody (M01), clone 2D7-E9 View larger

ZNF174 monoclonal antibody (M01), clone 2D7-E9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF174 monoclonal antibody (M01), clone 2D7-E9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about ZNF174 monoclonal antibody (M01), clone 2D7-E9

Brand: Abnova
Reference: H00007727-M01
Product name: ZNF174 monoclonal antibody (M01), clone 2D7-E9
Product description: Mouse monoclonal antibody raised against a full length recombinant ZNF174.
Clone: 2D7-E9
Isotype: IgG2b kappa
Gene id: 7727
Gene name: ZNF174
Gene alias: ZSCAN8
Gene description: zinc finger protein 174
Genbank accession: BC000876
Immunogen: ZNF174 (AAH00876, 1 a.a. ~ 234 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAAKMEITLSSNTEASSKQERHIIAKLEEKRGPPLQKNCPDPELCRQSFRRFCYQEVSGPQEALSQLRQLCRQWLQPELHTKEQILELLVMEQFLTILPPEIQARVRHRCPMSSKEIVTLVEDFHRASKKPKQWVAVCMQGQKVLLEKTGSQLGEQELPDFQPQTPRRDLRESSPAEPSQAGAYDRLSPHHWEKSPLLQEPTPKLAGTELLIEKTDPNMATDELPCKLWLSFIA
Protein accession: AAH00876
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007727-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (51.48 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007727-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to ZNF174 on HeLa cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice

Reviews

Buy ZNF174 monoclonal antibody (M01), clone 2D7-E9 now

Add to cart