TRIM26 monoclonal antibody (M01), clone 1G3 View larger

TRIM26 monoclonal antibody (M01), clone 1G3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TRIM26 monoclonal antibody (M01), clone 1G3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about TRIM26 monoclonal antibody (M01), clone 1G3

Brand: Abnova
Reference: H00007726-M01
Product name: TRIM26 monoclonal antibody (M01), clone 1G3
Product description: Mouse monoclonal antibody raised against a partial recombinant TRIM26.
Clone: 1G3
Isotype: IgG2a Kappa
Gene id: 7726
Gene name: TRIM26
Gene alias: AFP|RNF95|ZNF173
Gene description: tripartite motif-containing 26
Genbank accession: NM_003449
Immunogen: TRIM26 (NP_003440.1, 146 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: REKILNHLSTLRRDRDKIQGFQAKGEADILAALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLALVIS
Protein accession: NP_003440.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007726-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.19 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007726-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged TRIM26 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TRIM26 monoclonal antibody (M01), clone 1G3 now

Add to cart