ZNF157 monoclonal antibody (M04), clone 3G3 View larger

ZNF157 monoclonal antibody (M04), clone 3G3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF157 monoclonal antibody (M04), clone 3G3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ZNF157 monoclonal antibody (M04), clone 3G3

Brand: Abnova
Reference: H00007712-M04
Product name: ZNF157 monoclonal antibody (M04), clone 3G3
Product description: Mouse monoclonal antibody raised against a partial recombinant ZNF157.
Clone: 3G3
Isotype: IgG2a Kappa
Gene id: 7712
Gene name: ZNF157
Gene alias: HZF22
Gene description: zinc finger protein 157
Genbank accession: NM_003446
Immunogen: ZNF157 (NP_003437.1, 402 a.a. ~ 505 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: IEHQRMHSGEKPYECSECGKIFSMKKSLCQHRRTHTGEKPYECSECGNAFYVKVRLIEHQRIHTGERPFECQECGKAFCRKAHLTEHQRTHIGWSWRCTMKKAS
Protein accession: NP_003437.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007712-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.18 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007712-M04-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged ZNF157 is 3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZNF157 monoclonal antibody (M04), clone 3G3 now

Add to cart