ZNF155 monoclonal antibody (M01), clone 2F11 View larger

ZNF155 monoclonal antibody (M01), clone 2F11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF155 monoclonal antibody (M01), clone 2F11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ZNF155 monoclonal antibody (M01), clone 2F11

Brand: Abnova
Reference: H00007711-M01
Product name: ZNF155 monoclonal antibody (M01), clone 2F11
Product description: Mouse monoclonal antibody raised against a partial recombinant ZNF155.
Clone: 2F11
Isotype: IgG2a Kappa
Gene id: 7711
Gene name: ZNF155
Gene alias: MGC161655|pHZ-96
Gene description: zinc finger protein 155
Genbank accession: NM_003445
Immunogen: ZNF155 (NP_003436, 422 a.a. ~ 520 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: HSGEKPYKCEECGKGYVTKFNLDLHQRVHTGERPYNCKECGKNFSRASSILNHKRLHCQKKPFKCEDCGKRLVHRTYRKDQPRDYSGENPSKCEDCGRR
Protein accession: NP_003436
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007711-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007711-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged ZNF155 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZNF155 monoclonal antibody (M01), clone 2F11 now

Add to cart