ZNF154 monoclonal antibody (M01), clone 6G11 View larger

ZNF154 monoclonal antibody (M01), clone 6G11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF154 monoclonal antibody (M01), clone 6G11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ZNF154 monoclonal antibody (M01), clone 6G11

Brand: Abnova
Reference: H00007710-M01
Product name: ZNF154 monoclonal antibody (M01), clone 6G11
Product description: Mouse monoclonal antibody raised against a partial recombinant ZNF154.
Clone: 6G11
Isotype: IgG2a Kappa
Gene id: 7710
Gene name: ZNF154
Gene alias: MGC176628|MGC176661|pHZ-92
Gene description: zinc finger protein 154
Genbank accession: NM_003444
Immunogen: ZNF154 (NP_003435, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAVATLRTPTQGTVTFEDVAVHFSWEEWGLLDEAQRCLYRDVMLENLALLTSLDVHHQKQHLGEKHFRSNVGRALFVKTCTFHVSGEPSTCREVGKDF
Protein accession: NP_003435
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007710-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007710-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged ZNF154 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZNF154 monoclonal antibody (M01), clone 6G11 now

Add to cart