Brand: | Abnova |
Reference: | H00007704-M02 |
Product name: | ZBTB16 monoclonal antibody (M02), clone 1F10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ZBTB16. |
Clone: | 1F10 |
Isotype: | IgG2a Kappa |
Gene id: | 7704 |
Gene name: | ZBTB16 |
Gene alias: | PLZF|ZNF145 |
Gene description: | zinc finger and BTB domain containing 16 |
Genbank accession: | BC029812 |
Immunogen: | ZBTB16 (AAH29812, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QRELFSKLGELAVGMKSESRTIGEQCSVCGVELPDNEAVEQHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHR |
Protein accession: | AAH29812 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ZBTB16 is approximately 0.03ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |