ZBTB16 monoclonal antibody (M01), clone 3A7 View larger

ZBTB16 monoclonal antibody (M01), clone 3A7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZBTB16 monoclonal antibody (M01), clone 3A7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Tr,PLA-Ce

More info about ZBTB16 monoclonal antibody (M01), clone 3A7

Brand: Abnova
Reference: H00007704-M01
Product name: ZBTB16 monoclonal antibody (M01), clone 3A7
Product description: Mouse monoclonal antibody raised against a partial recombinant ZBTB16.
Clone: 3A7
Isotype: IgG2a Kappa
Gene id: 7704
Gene name: ZBTB16
Gene alias: PLZF|ZNF145
Gene description: zinc finger and BTB domain containing 16
Genbank accession: BC029812
Immunogen: ZBTB16 (AAH29812, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QRELFSKLGELAVGMKSESRTIGEQCSVCGVELPDNEAVEQHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHR
Protein accession: AAH29812
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007704-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged ZBTB16 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Tr,PLA-Ce
Shipping condition: Dry Ice

Reviews

Buy ZBTB16 monoclonal antibody (M01), clone 3A7 now

Add to cart