Brand: | Abnova |
Reference: | H00007697-M01 |
Product name: | ZNF138 monoclonal antibody (M01), clone 4D11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ZNF138. |
Clone: | 4D11 |
Isotype: | IgG2a Kappa |
Gene id: | 7697 |
Gene name: | ZNF138 |
Gene alias: | pHZ-32 |
Gene description: | zinc finger protein 138 |
Genbank accession: | NM_006524 |
Immunogen: | ZNF138 (NP_006515.1, 151 a.a. ~ 251 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TNLSKPKKIHTGEKPYKCEVCGKAFHQSSILTKHKIIRTGEKPYKCAHCGKAFKQSSHLTRHKIIHTEEKPYKCEQCGKVFKQSPTLTKHQIIYTGEEPYK |
Protein accession: | NP_006515.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.85 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to ZNF138 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |