ZNF138 monoclonal antibody (M01), clone 4D11 View larger

ZNF138 monoclonal antibody (M01), clone 4D11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF138 monoclonal antibody (M01), clone 4D11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re,WB-Tr

More info about ZNF138 monoclonal antibody (M01), clone 4D11

Brand: Abnova
Reference: H00007697-M01
Product name: ZNF138 monoclonal antibody (M01), clone 4D11
Product description: Mouse monoclonal antibody raised against a partial recombinant ZNF138.
Clone: 4D11
Isotype: IgG2a Kappa
Gene id: 7697
Gene name: ZNF138
Gene alias: pHZ-32
Gene description: zinc finger protein 138
Genbank accession: NM_006524
Immunogen: ZNF138 (NP_006515.1, 151 a.a. ~ 251 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TNLSKPKKIHTGEKPYKCEVCGKAFHQSSILTKHKIIRTGEKPYKCAHCGKAFKQSSHLTRHKIIHTEEKPYKCEQCGKVFKQSPTLTKHQIIYTGEEPYK
Protein accession: NP_006515.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007697-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.85 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007697-M01-3-36-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to ZNF138 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
Applications: IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ZNF138 monoclonal antibody (M01), clone 4D11 now

Add to cart