ZNF134 monoclonal antibody (M03), clone 2D10 View larger

ZNF134 monoclonal antibody (M03), clone 2D10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF134 monoclonal antibody (M03), clone 2D10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about ZNF134 monoclonal antibody (M03), clone 2D10

Brand: Abnova
Reference: H00007693-M03
Product name: ZNF134 monoclonal antibody (M03), clone 2D10
Product description: Mouse monoclonal antibody raised against a partial recombinant ZNF134.
Clone: 2D10
Isotype: IgG2a Kappa
Gene id: 7693
Gene name: ZNF134
Gene alias: MGC138499|MGC141970|pHZ-15
Gene description: zinc finger protein 134
Genbank accession: NM_003435
Immunogen: ZNF134 (NP_003426.2, 105 a.a. ~ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PLRRDKSEASIVRNCTVSKEPHPSEKPFTCKEEQKNFQATLGGCQQKAIHSKRKTHRSTESGDAFHGEQMHYKCSECGKAFSRKDTLVQ
Protein accession: NP_003426.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007693-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.53 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007693-M03-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged ZNF134 is 0.1 ng/ml as a capture antibody.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZNF134 monoclonal antibody (M03), clone 2D10 now

Add to cart