Brand: | Abnova |
Reference: | H00007692-M01 |
Product name: | ZNF133 monoclonal antibody (M01), clone 1C6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ZNF133. |
Clone: | 1C6 |
Isotype: | IgG2a Kappa |
Gene id: | 7692 |
Gene name: | ZNF133 |
Gene alias: | ZNF150|pHZ-13|pHZ-66 |
Gene description: | zinc finger protein 133 |
Genbank accession: | NM_003434 |
Immunogen: | ZNF133 (NP_003425, 121 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PGPGDQEKQQQASEGRPWSDQAEGPEGEGAMPLFGRTKKRTLGAFSRPPQRQPVSSRNGLRGVELEASPAQTGNPEETDKLLKRIEVLGFGTVNCGECGLSFSKMTNLLS |
Protein accession: | NP_003425 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged ZNF133 is approximately 30ng/ml as a capture antibody. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Comparative proteomics analysis of human osteosarcomas and benign tumor of bone.Li Y, Liang Q, Wen YQ, Chen LL, Wang LT, Liu YL, Luo CQ, Liang HZ, Li MT, Li Z. Cancer Genet Cytogenet. 2010 Apr 15;198(2):97-106. |