ZNF133 monoclonal antibody (M01), clone 1C6 View larger

ZNF133 monoclonal antibody (M01), clone 1C6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF133 monoclonal antibody (M01), clone 1C6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about ZNF133 monoclonal antibody (M01), clone 1C6

Brand: Abnova
Reference: H00007692-M01
Product name: ZNF133 monoclonal antibody (M01), clone 1C6
Product description: Mouse monoclonal antibody raised against a partial recombinant ZNF133.
Clone: 1C6
Isotype: IgG2a Kappa
Gene id: 7692
Gene name: ZNF133
Gene alias: ZNF150|pHZ-13|pHZ-66
Gene description: zinc finger protein 133
Genbank accession: NM_003434
Immunogen: ZNF133 (NP_003425, 121 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PGPGDQEKQQQASEGRPWSDQAEGPEGEGAMPLFGRTKKRTLGAFSRPPQRQPVSSRNGLRGVELEASPAQTGNPEETDKLLKRIEVLGFGTVNCGECGLSFSKMTNLLS
Protein accession: NP_003425
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007692-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: http://www.abnova.com/application_image/
Application image note: Detection limit for recombinant GST tagged ZNF133 is approximately 30ng/ml as a capture antibody.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Comparative proteomics analysis of human osteosarcomas and benign tumor of bone.Li Y, Liang Q, Wen YQ, Chen LL, Wang LT, Liu YL, Luo CQ, Liang HZ, Li MT, Li Z.
Cancer Genet Cytogenet. 2010 Apr 15;198(2):97-106.

Reviews

Buy ZNF133 monoclonal antibody (M01), clone 1C6 now

Add to cart